PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.RDF0H
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 97aa    MW: 11276 Da    PI: 9.7216
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.RDF0HgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.98.6e-171562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l+++    G g+W+ Iar  g+ R++k+c++rw +yl
      Aradu.RDF0H 15 KGLWSPEEDEKLIRYMITKGEGCWSDIARNAGLERCGKSCRLRWINYL 62
                     678*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.1231066IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.4E-231165IPR009057Homeodomain-like
SMARTSM007171.8E-131464IPR001005SANT/Myb domain
PfamPF002493.5E-151562IPR001005SANT/Myb domain
SuperFamilySSF466891.59E-211790IPR009057Homeodomain-like
CDDcd001671.06E-101862No hitNo description
Gene3DG3DSA:1.10.10.602.8E-76689IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 97 aa     Download sequence    Send to blast
MVKEKSKNNG SKQRKGLWSP EEDEKLIRYM ITKGEGCWSD IARNAGLERC GKSCRLRWIN  60
YLRPDLKRGA FSLQEEDLII HLHSILGNRC IFLSTHT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-14159427105MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015936844.12e-59PREDICTED: transcription factor MYB21-like
SwissprotQ9LXV23e-44MYB46_ARATH; Transcription factor MYB46
TrEMBLA0A059PRF63e-49A0A059PRF6_SALMI; MYB-related transcription factor
STRINGGLYMA13G07020.23e-48(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.11e-48myb domain protein 83